PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G340100.1.p
Common NameSb03g038410, SORBIDRAFT_03g038410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 249aa    MW: 26226.5 Da    PI: 6.5064
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G340100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.2e-40571561100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+kll ++ e er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ 
  Sobic.003G340100.1.p  57 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKLLLEVAEGERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNA 145
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ael+++++e
  Sobic.003G340100.1.p 146 LEAELEAVRAE 156
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.05756157IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4057154IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSTERERVDE IGKKIKREPD TAALAVAVAS ASTVPADNHI PHRLGLGLGG VLNTLTPCAA  60
CKLLRRRCAQ ECPFAPYFSP HEPHKFAAVH KVFGASNVSK LLLEVAEGER ADAASSLVYE  120
ANLRLRDPVY GCMGAISMLQ QQVNALEAEL EAVRAEILKH RYRQAGGGNR LIDDDAHATA  180
SFVAPASAPV HVNDVVSVVE AGQEVAATGG GASGMSTSSA VYVAEAEQPA STNHYSSRNP  240
SEHPAYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0686990.0BT068699.1 Zea mays full-length cDNA clone ZM_BFb0375M24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456560.10.0hypothetical protein SORBIDRAFT_03g038410
SwissprotQ8L5T51e-69LBD15_ARATH; LOB domain-containing protein 15
TrEMBLC5XNC30.0C5XNC3_SORBI; Putative uncharacterized protein Sb03g038410
STRINGSb03g038410.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-62LOB domain-containing protein 15